Saturday, August 21, 2010

9 Nama-Nama Terpanjang di Dunia

1. Nama Orang Terpanjang

Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown

Nama yang mempunyai 27 perkataan ini adalah milik seorang lelaki di UK. Namanya diambil dari 25 nama petinju terkenal dari seluruh dunia.

Baki 2 nama lagi adalah nama depan dan nama keluarga. Agak-agaknya di Malaysia, siapa yang mempunyai nama terpanjang ya?


2. Nama Kampung Terpanjang

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch


ialah nama sebuah kampung di pulau Anglesey di Wales, Britain. Kampung ini tercatat di dalam Guiness Book of Record sebagai tempat yang namanya terpanjang di Britain. Bagaimana sebutannya agak-agaknya?



3. Nama Bukit Terpanjang

Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwhenuakitanatahu

adalah nama sebuah bukit di Porangahau, di selatan Waipukurau, di selatan Hawke's Bay, New Zealand. Nama ini biasanya disingkatkan menjadi Taumata.



4. Nama Album Terpanjang

He Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almightyadalah

adala nama sebuah album yang dihasilkan oleh bekas penyanyi Sin Ad O'Connor


5. Nama Domain dan Nama Kota Terpanjang

http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/

merupakan laman web untuk mempromosikan sebuah kota di Anglesey, Gwynedd, UK. Nama kotanya juga sama panjangnya dengan nama laman web ini.



6. Nama E-Mail Terpanjang

yourname@abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijk.com

nama yang sangat panjang untuk sebuah email address cara daftarnya, masuk saja ke webnya di http://www.abcdefghijklmnopqrstuvwxyzabcdefghi jklmnopqrstuvwxyzabcdefghijk.com/



7. Nama Tempat Terpanjang


Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwes hasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit

adalah nama sebuah tempat di Thailand yang telah diiktiraf oleh Guinness book of Record sebagai nama tempat terpanjang di dunia.



8. Nama Negara Terpanjang

Al Jumahiriyah al Arabiyah al Libiyah ash Shabiyah al Ishtirakiyah al Uzma

adalah nama rasmi bagi negara Libya.



9. Nama Filem Terpanjang

Night of the Day of the Dawn of the Son of the Bride of the Return of the Revenge of the Terror of the Attack of the Evil, Mutant, Alien, Flesh Eating, Hellbound, Zombified Living Dead Part 2: In Shocking 2-D

adalah nama filem terpanjang yang mempunyai 41 perkataan dan 16 huruf. Filem ini dihasilkan pada tahun 1991.


sumber: wikipedia, purpleslinky.com



Entri-Entri Berkaitan.....

10 comments:

  1. panjangnya nama orang tue...wonder what it is for?at last nama yg paling singkat jugak org akan panggil

    ReplyDelete
  2. mak aih. ade rupanya tajuk filem camtuh. xpernah tahu la plak. hehe... nak try tengok la citer tuh.. :D

    ReplyDelete
  3. itulah...tak tahu pulak ada tajuk filem cm tuh...kalu jumpa filem tu nanti share ngn aku skali, ok? huhu

    ReplyDelete
  4. Ada ada je manusia ni...suka cari nama...

    ReplyDelete
  5. nama singkatan terpanjang ada di Malaysia

    ReplyDelete
  6. nama gabenor Amerika...Anodsusahnakeja..

    ReplyDelete
  7. wahhhh Pnjg betul ! i cuba sebut nama filem tu dalam 1 nafas, semput ! haha

    ReplyDelete
  8. oh silap, rupanya abbreviation terpanjang di dunia yg dekat Malaysia tu bukan. Tak silap dulu pernah baca dlm paper cakap ia adalah terpanjang di dunia...

    S.K.O.M.K.H.P.K.J.C.D.P.W.B.

    Syarikat Kerjasama Orang-orang Melayu Kerajaan Hilir Perak Kerana Jimat Cermat Dan Pinjam-meminjam Wang Berhad.

    ReplyDelete
  9. tajuk lagu paling panjang pernah di sampaikan oleh kumpulan jambu tym maharaja lawak....hahahha

    ReplyDelete

Related Posts with Thumbnails