Skip to main content

9 Nama-Nama Terpanjang di Dunia

1. Nama Orang Terpanjang

Autumn Sullivan Corbett Fitzsimmons Jeffries Hart Burns Johnson Willard Dempsey Tunney Schmeling Sharkey Carnera Baer Braddock Louis Charles Walcott Marciano Patterson Johansson Liston Clay Frazier Foreman Brown

Nama yang mempunyai 27 perkataan ini adalah milik seorang lelaki di UK. Namanya diambil dari 25 nama petinju terkenal dari seluruh dunia.

Baki 2 nama lagi adalah nama depan dan nama keluarga. Agak-agaknya di Malaysia, siapa yang mempunyai nama terpanjang ya?

2. Nama Kampung Terpanjang


ialah nama sebuah kampung di pulau Anglesey di Wales, Britain. Kampung ini tercatat di dalam Guiness Book of Record sebagai tempat yang namanya terpanjang di Britain. Bagaimana sebutannya agak-agaknya?

3. Nama Bukit Terpanjang


adalah nama sebuah bukit di Porangahau, di selatan Waipukurau, di selatan Hawke's Bay, New Zealand. Nama ini biasanya disingkatkan menjadi Taumata.

4. Nama Album Terpanjang

He Who Dwells in the Secret Place of the Most High Shall Abide Under the Shadow of the Almightyadalah

adala nama sebuah album yang dihasilkan oleh bekas penyanyi Sin Ad O'Connor

5. Nama Domain dan Nama Kota Terpanjang

merupakan laman web untuk mempromosikan sebuah kota di Anglesey, Gwynedd, UK. Nama kotanya juga sama panjangnya dengan nama laman web ini.

6. Nama E-Mail Terpanjang

nama yang sangat panjang untuk sebuah email address cara daftarnya, masuk saja ke webnya di http://www.abcdefghijklmnopqrstuvwxyzabcdefghi

7. Nama Tempat Terpanjang

Krungthepmahanakonbowornratanakosinmahintarayudyayamahadiloponoparatanarajthaniburiromudomrajniwes hasatarnamornpimarnavatarsatitsakattiyavisanukamphrasit

adalah nama sebuah tempat di Thailand yang telah diiktiraf oleh Guinness book of Record sebagai nama tempat terpanjang di dunia.

8. Nama Negara Terpanjang

Al Jumahiriyah al Arabiyah al Libiyah ash Shabiyah al Ishtirakiyah al Uzma

adalah nama rasmi bagi negara Libya.

9. Nama Filem Terpanjang

Night of the Day of the Dawn of the Son of the Bride of the Return of the Revenge of the Terror of the Attack of the Evil, Mutant, Alien, Flesh Eating, Hellbound, Zombified Living Dead Part 2: In Shocking 2-D

adalah nama filem terpanjang yang mempunyai 41 perkataan dan 16 huruf. Filem ini dihasilkan pada tahun 1991.

sumber: wikipedia,


  1. panjangnya nama orang tue...wonder what it is for?at last nama yg paling singkat jugak org akan panggil

  2. mak aih. ade rupanya tajuk filem camtuh. xpernah tahu la plak. hehe... nak try tengok la citer tuh.. :D

  3. itulah...tak tahu pulak ada tajuk filem cm tuh...kalu jumpa filem tu nanti share ngn aku skali, ok? huhu

  4. Ada ada je manusia ni...suka cari nama...

  5. nama singkatan terpanjang ada di Malaysia

  6. nama gabenor Amerika...Anodsusahnakeja..

  7. wahhhh Pnjg betul ! i cuba sebut nama filem tu dalam 1 nafas, semput ! haha

  8. oh silap, rupanya abbreviation terpanjang di dunia yg dekat Malaysia tu bukan. Tak silap dulu pernah baca dlm paper cakap ia adalah terpanjang di dunia...


    Syarikat Kerjasama Orang-orang Melayu Kerajaan Hilir Perak Kerana Jimat Cermat Dan Pinjam-meminjam Wang Berhad.

  9. tajuk lagu paling panjang pernah di sampaikan oleh kumpulan jambu tym maharaja lawak....hahahha


Post a Comment

Popular posts from this blog

15 Kepercayaan Masyarakat Melayu Mengenai Tanda-Tanda Alam

Ada banyak kepercayaan masyarakat Melayu lama yang berhubungan dengan tanda-tanda alam. Ramai yang masih mempercayainya dan tidak kurang juga yang menganggapnya sebagai kepercayaan tahayul. Tanda-tanda alam itu boleh memberi gambaran maksud negatif atau positif. 1. Kalau kupu-kupu masuk ke dalam sesebuah rumah, itu menandakan ada orang jauh yang akan datang ke rumah.

Petua Hilangkan Dakwat Pen Pada Pakaian

BILA pakaian anda terutamanya yang berwarna putih terkena dakwat pen memang haru biru jadinya. Silap-silap baju yang baru dibeli pun anda akan buang. Pun begitu, jangan pening kepala ya. Femina ada petuanya untuk menghilangkan dakwat berkenaan, yang penting anda berusaha. 1) Air limau Titiskan air limau yang dicampurkan dengan garam pada bahagian baju yang kotor terkena dakwat. Tunggu seketika dan gosok perlahan-lahan. Kemudian cuci baju itu seperti biasa.

Hukum Memakan Strepsils Yang Mengandungi Alkohol

Encik Billy terkejut la jugak bila adik en Billy kata haram memakan Strepsils sebab ada alkohol. Dia kata lebih baik makan Fisherman's Friend sebab takde alkohol. En Billy terkejut dan tak percaya. Biar betul? Ya, memang betul! Kalau tengok label kat belakang pek tu memang ada tertulis perkataan alcohol.  So, Encik Billy pun puaslah menjelajah mencari bukti bendahalah Strepsils ni haram dimakan. Dan rumusannya, Strepsils ni hukumnya HARUS dimakan dan tidak berdosa. Sila baca lanjutan artikel ini di bawah jika ingin tahu dengan lebih lanjut.